PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_96853g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 582aa    MW: 63159.3 Da    PI: 5.6121
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_96853g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-183784148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lv++vk++G g+W+++ ++ g+ R++k+c++rw ++l
    MA_96853g0010 37 KGPWTSAEDAILVEYVKKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 84
                     79******************************************9986 PP

2Myb_DNA-binding51.52.3e-1690133146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++TteE+ ++++++++lG++ W++ a+ ++ gRt++++k++w++
    MA_96853g0010  90 KGAFTTEEERKILELHAKLGNK-WARMAAQLP-GRTDNEIKNYWNT 133
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2923484IPR017930Myb domain
SuperFamilySSF466892.58E-3035131IPR009057Homeodomain-like
SMARTSM007176.1E-163686IPR001005SANT/Myb domain
PfamPF002496.0E-163784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-243891IPR009057Homeodomain-like
CDDcd001676.26E-123984No hitNo description
PROSITE profilePS5129425.36685139IPR017930Myb domain
SMARTSM007173.4E-1589137IPR001005SANT/Myb domain
PfamPF002495.4E-1590133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-2492138IPR009057Homeodomain-like
CDDcd001672.72E-1192133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MALVVYGNVA ASASASASAS ATGATEQATE EVGTLKKGPW TSAEDAILVE YVKKHGEGNW  60
NAVQKHSGLS RCGKSCRLRW ANHLRPNLRK GAFTTEEERK ILELHAKLGN KWARMAAQLP  120
GRTDNEIKNY WNTRIKRRQR AGLPLYPPDI QLQNSNQKAP QTPTELNSVD APYERRPPNN  180
PLMFNAKAEI GTANFDGLKH VNTSPMPFSG LGDVLLGSMF HQANPIQRLK RLRDTGFSMG  240
SPSSAFGHVG VNGHMGMNDV SKSLQPCFKA RHPYPQAARS DSFAAQGCLP YDPDFISTSN  300
LPLGGFSSGI HAVMNGTFSA SRPFSGRKSE LPSSQFAESV QTAGSSVNPV LNMSNPLSLP  360
PLPTHMTNQV DFIFSTQKNS GLLEAMLEES QTMSGVKAPS SSNSSVDLQG VSISSNSNAM  420
SNVFPFPSKI KRGDNSDPTT PLDGHTFSVF SESTPPLGTS PWDESSSAQS PIGKIMKSEE  480
PNEEFISPGS CEKILDFTPD LLPDFDWNEQ IDDTEKEQSN LDDALASMEK EQSHIDDALA  540
SMEKEQSHID DALASFYPGD LAPSSQTWEV DSFPWSNISG VC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-33351385107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K0M7041e-137A0A0K0M704_PINTB; MYB33
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.13e-72myb domain protein 65